PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.E03954.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family MIKC_MADS
Protein Properties Length: 173aa    MW: 19217.5 Da    PI: 6.6836
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.E03954.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF83.61.2e-261160251
                    ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
          SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                    rie+   rqv fskRr+g++KKA+ELS LCdaeva+i+fs+ gklyey+s
  Pahal.E03954.1 11 RIEDRVSRQVRFSKRRAGLFKKAFELSLLCDAEVALIVFSPAGKLYEYAS 60
                    8***********************************************86 PP

2K-box22.35.4e-09951502677
           K-box  26 keienLqreqRhllGedLes....LslkeLqqLeqqLekslkkiRskKnellleqi 77 
                     +e + Lq+++R ++  +L+s     + +eL++Le+ L+++l+  RskK++ll +q 
  Pahal.E03954.1  95 DEASDLQSTLREIVTWCLQSnpdeSDANELEKLENLLKNALRDTRSKKMQLLAKQN 150
                     6667788888888888886522225789************************9996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004324.9E-33261IPR002100Transcription factor, MADS-box
PROSITE profilePS5006629.072262IPR002100Transcription factor, MADS-box
CDDcd002654.70E-40376No hitNo description
SuperFamilySSF554557.06E-30475IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-27424IPR002100Transcription factor, MADS-box
PfamPF003191.6E-251158IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-272439IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-273960IPR002100Transcription factor, MADS-box
PfamPF014862.6E-594149IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 173 aa     Download sequence    Send to blast
MPRRGRVELR RIEDRVSRQV RFSKRRAGLF KKAFELSLLC DAEVALIVFS PAGKLYEYAS  60
ASIEDTYDRY QQFAGAAGDE NGDRNGNDPK ISNKDEASDL QSTLREIVTW CLQSNPDESD  120
ANELEKLENL LKNALRDTRS KKMQLLAKQN SGEGTSGQGC NVVAIKQEQG TA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3p57_J2e-18473271Myocyte-specific enhancer factor 2A
3p57_I2e-18473271Myocyte-specific enhancer factor 2A
3p57_D2e-18473271Myocyte-specific enhancer factor 2A
3p57_C2e-18473271Myocyte-specific enhancer factor 2A
3p57_B2e-18473271Myocyte-specific enhancer factor 2A
3p57_A2e-18473271Myocyte-specific enhancer factor 2A
3kov_J2e-18473271Myocyte-specific enhancer factor 2A
3kov_I2e-18473271Myocyte-specific enhancer factor 2A
3kov_B2e-18473271Myocyte-specific enhancer factor 2A
3kov_A2e-18473271Myocyte-specific enhancer factor 2A
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHM1305252e-82HM130525.1 Hordeum vulgare subsp. vulgare cultivar Igri ODDSOC1 (ODDSOC1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004968191.12e-86PREDICTED: truncated transcription factor CAULIFLOWER A-like
TrEMBLA0A059Q0S23e-75A0A059Q0S2_9POAL; MADS-box transcription factor
STRINGSb03g044170.11e-72(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP12938398
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G22950.11e-30AGAMOUS-like 19